Germany
Japan
United Kingdom
China
CERK rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from human ceramide kinase protein |
Primary Antibodies
View as table DownloadRabbit Polyclonal Anti-CERK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS |
CERK Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CERK Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CERK |
CERK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CERK
Applications
- WB
Clonalities
- Polyclonal