Primary Antibodies

View as table Download

Goat Polyclonal Antibody against KLK5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KAGRDSCQGD, from the internal region of the protein sequence according to NP_036559.1; NP_001070959.1; NP_001070960.1.

Rabbit Polyclonal Kallikrein 5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Residues 280-293 [KFTKWIQETIQANS] of the human KLK-L2 protein.

Rabbit Polyclonal Anti-KLK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLK5 Antibody: synthetic peptide directed towards the N terminal of human KLK5. Synthetic peptide located within the following region: CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL

Anti-KLK5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5

KLK5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KLK5 (NP_001070959.1).
Modifications Unmodified