Primary Antibodies

Jump to Filters
View as table Download
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA346234

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA321231

USD 345.00

In Stock

Anti-NPY Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein