Primary Antibodies

View as table Download

Rabbit polyclonal anti-PTPN22 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTPN22.

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22

PTPN22 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 662-691aa) of human PTPN22.

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN22

PTPN22 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PTPN22 (NP_036543.4).
Modifications Unmodified