Goat Polyclonal Antibody against SV2A
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TVELYPSDKRTTA, from the internal region of the protein sequence according to NP_055664.2. |
Goat Polyclonal Antibody against SV2A
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TVELYPSDKRTTA, from the internal region of the protein sequence according to NP_055664.2. |
Rabbit Polyclonal Anti-SV2A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT |
SV2A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3). |
Modifications | Unmodified |