SV2A Rabbit Polyclonal Antibody

CAT#: TA341964

Rabbit Polyclonal Anti-SV2A Antibody

Product Images

WB Suggested Anti-SV2A Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: synaptic vesicle glycoprotein 2A
• Database Link:
  NP_055664
  Entrez Gene 64051 MouseEntrez Gene 9900 Human
  UniProt ID Q7L0J3
• Background: Plays a role inThe control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintainingThe readily releasable pool of secretory vesicles.
• Synonyms: SV2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: ECM-receptor interaction