Rabbit polyclonal UBP1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This UBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-295 amino acids from the Central region of human UBP1. |
Rabbit Polyclonal Anti-UBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED |
Germany
Japan
United Kingdom
China
