XAB2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XAB2 |
XAB2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XAB2 |
Goat Polyclonal Antibody against XAB2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2. |
Rabbit Polyclonal Anti-XAB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the N terminal of human XAB2. Synthetic peptide located within the following region: VKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKH |
Rabbit Polyclonal Anti-XAB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the C terminal of human XAB2. Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS |
XAB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XAB2 |
XAB2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 761-855 of human XAB2 (NP_064581.2). |
Modifications | Unmodified |