XAB2 Rabbit Polyclonal Antibody

CAT#: TA339735

Rabbit Polyclonal Anti-XAB2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "XAB2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the N terminal of human XAB2. Synthetic peptide located within the following region: VKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 100 kDa
Gene Name XPA binding protein 2
Background XAB2 belongs to the crooked-neck family. It contains 14 HAT repeats. XAB2 is involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Synonyms HCNP; HCRN; NTC90; SYF1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.