Primary Antibodies

Jump to Filters
View as table Download
GPR56 (ADGRG1) Rabbit Polyclonal Antibody
TA344257

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPR56 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
GPR56 (ADGRG1) Rabbit Polyclonal Antibody
TA373293

USD 275.00

3 Weeks

ADGRG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ADGRG1.