GPR56 (ADGRG1) Rabbit Polyclonal Antibody

CAT#: TA344257

Rabbit Polyclonal Anti-GPR56 Antibody - N-terminal region

Product Images

WB Suggested Anti-GPR56 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: adhesion G protein-coupled receptor G1
• Database Link:
  NP_005673
  Entrez Gene 9289 Human
  UniProt ID Q9Y653
• Background: GPR56 could be involved in cell-cell interactions.
• Synonyms: BFPP; BPPR; GPR56; TM7LN4; TM7XN1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane