GPR56 (ADGRG1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1
USD 867.00
Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1
USD 396.00
Other products for "ADGRG1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 76 kDa |
Gene Name | adhesion G protein-coupled receptor G1 |
Database Link | |
Background | GPR56 could be involved in cell-cell interactions. |
Synonyms | BFPP; BPPR; GPR56; TM7LN4; TM7XN1 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 79% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.