Primary Antibodies

View as table Download

Rabbit Polyclonal DEK Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-DEK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEK antibody: synthetic peptide directed towards the middle region of human DEK. Synthetic peptide located within the following region: ELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKEL

Rabbit Polyclonal Anti-DEK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEK antibody: synthetic peptide directed towards the N terminal of human DEK. Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG

DEK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DEK (NP_003463.1).
Modifications Unmodified