DEK Rabbit Polyclonal Antibody

CAT#: TA330034

Rabbit Polyclonal Anti-DEK Antibody

Product Images

WB Suggested Anti-DEK Antibody Titration: 1.25ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DEK antibody: synthetic peptide directed towards the N terminal of human DEK. Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: DEK proto-oncogene
• Database Link:
  NP_003463
  Entrez Gene 7913 Human
  UniProt ID P35659
• Background: This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
• Synonyms: D6S231E
• Note: Immunogen sequence homology: Human: 100%; Guinea pig: 92%; Horse: 92%; Pig: 92%; Rabbit: 85%; Rat: 85%; Bovine: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors