Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DEK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEK antibody: synthetic peptide directed towards the middle region of human DEK. Synthetic peptide located within the following region: ELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKEL |
Rabbit Polyclonal Anti-DEK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEK antibody: synthetic peptide directed towards the N terminal of human DEK. Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG |
DEK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human DEK (NP_003463.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DEK