Primary Antibodies

View as table Download

Rabbit polyclonal Anti-Kir3.3 (GIRK3)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)RLDAHLYWSIPSRLDEKV, corresponding to residues 344-361 of rat Kir3.3 .? ? Intracellular, C-terminus.

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ9 antibody: synthetic peptide directed towards the middle region of human KCNJ9. Synthetic peptide located within the following region: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

KCNJ9 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNJ9 (NP_004974.2).
Modifications Unmodified