KCNJ9 Rabbit Polyclonal Antibody

CAT#: TA338552

Rabbit Polyclonal Anti-KCNJ9 Antibody

Product Images

WB Suggested Anti-KCNJ9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: NCI-H226 cell lysate KCNJ9 is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNJ9 antibody: synthetic peptide directed towards the middle region of human KCNJ9. Synthetic peptide located within the following region: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: potassium voltage-gated channel subfamily J member 9
• Database Link:
  NP_004974
  Entrez Gene 3765 Human
  UniProt ID Q92806
• Background: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. [provided by RefSeq, Jul 2008]
• Synonyms: GIRK3; KIR3.3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Goat: 93%; Rabbit: 93%; Zebrafish: 92%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane