Rabbit polyclonal Anti-Kir3.3 (GIRK3)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RLDAHLYWSIPSRLDEKV, corresponding to residues 344-361 of rat Kir3.3 .? ? Intracellular, C-terminus. |
Rabbit polyclonal Anti-Kir3.3 (GIRK3)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RLDAHLYWSIPSRLDEKV, corresponding to residues 344-361 of rat Kir3.3 .? ? Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNJ9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNJ9 antibody: synthetic peptide directed towards the middle region of human KCNJ9. Synthetic peptide located within the following region: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR |
Rabbit Polyclonal Anti-KCNJ9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ9 |
KCNJ9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ9 |
KCNJ9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNJ9 (NP_004974.2). |
Modifications | Unmodified |