Antibodies

View as table Download

Rabbit polyclonal Anti-Kir3.3 (GIRK3)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)RLDAHLYWSIPSRLDEKV, corresponding to residues 344-361 of rat Kir3.3 .? ? Intracellular, C-terminus.

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ9 antibody: synthetic peptide directed towards the middle region of human KCNJ9. Synthetic peptide located within the following region: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

KCNJ9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

KCNJ9 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNJ9 (NP_004974.2).
Modifications Unmodified