Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the C terminal of human SNRP70. Synthetic peptide located within the following region: RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS

SNRNP70 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RU17

SNRNP70 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SNRNP70 (NP_003080.2).
Modifications Unmodified

SNRNP70 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SNRNP70 (NP_003080.2).
Modifications Unmodified