SNRP70 (SNRNP70) Rabbit Polyclonal Antibody

CAT#: TA345724

Rabbit Polyclonal Anti-SNRP70 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human small nuclear ribonucleoprotein 70kDa (U1) (SNRNP70)
    • 20 ug

USD 823.00


Transient overexpression lysate of small nuclear ribonucleoprotein 70kDa (U1) (SNRNP70)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SNRNP70"

Specifications

Product Data
Applications WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name small nuclear ribonucleoprotein U1 subunit 70
Background SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms RNPU1Z; RPU1; Snp1; SNRP70; U1-70K; U1AP; U1RNP; U170K
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.