Primary Antibodies

Jump to Filters
View as table Download
STK16 Rabbit Polyclonal Antibody
TA346579

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
STK16 Rabbit Polyclonal Antibody
TA350459

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK16 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16
STK16 Rabbit Polyclonal Antibody
TA382123

USD 220.00

3 Weeks

STK16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human STK16 (NP_001008910.1).
Modifications Unmodified