STK16 Rabbit Polyclonal Antibody

CAT#: TA346579

Rabbit Polyclonal Anti-STK16 Antibody

Product Images

WB Suggested Anti-STK16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human brain

• 

  STK16 antibody - middle region validated by WB using Hek 293T Cells at 1: 1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: serine/threonine kinase 16
• Database Link:
  NP_003682
  Entrez Gene 8576 Human
  UniProt ID O75716
• Background: STK16 is a protein kinase that acts on both serine and threonine residues.
• Synonyms: FLJ39635; KRCT; MPSK; PKL12; protein kinase expressed in day 12 fetal liver; serine; threonine kinase 16; TSF1
• Note: Immunogen Sequence Homology: Dog: 100%; Goat: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase