Primary Antibodies

Jump to Filters
View as table Download
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA306502

USD 430.00

In Stock

Rabbit Polyclonal ZBP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1.
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA341712

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
ZBP1 Rabbit Polyclonal Antibody
TA366745

USD 380.00

4 Weeks

ZBP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZBP1
ZBP1 Rabbit Polyclonal Antibody
TA366746

USD 380.00

4 Weeks

ZBP1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZBP1
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA383431

USD 220.00

3 Weeks

ZBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ZBP1 (NP_110403.2).
Modifications Unmodified