Primary Antibodies

View as table Download

Rabbit Polyclonal DEK Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

DEK (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 343~372 amino acids from the C-terminal region of human DEK

Rabbit Polyclonal Anti-DEK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEK antibody: synthetic peptide directed towards the middle region of human DEK. Synthetic peptide located within the following region: ELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKEL

Rabbit Polyclonal Anti-DEK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEK antibody: synthetic peptide directed towards the N terminal of human DEK. Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG