Primary Antibodies

View as table Download

Rabbit anti-RBP4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human RBP4

RBP4 mouse monoclonal antibody, clone AT2B4, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

RBP4 mouse monoclonal antibody, clone AT2B4, Purified

Applications ELISA, IHC, WB
Reactivities Human

Goat Polyclonal Antibody against RBP4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKGNDDHWIVDTDYD, from the internal region of the protein sequence according to NP_006735.2.

Goat Polyclonal Antibody against RBP4 (Internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DTEDPAKFKMKY, from the internal region of the protein sequence according to NP_006735.2.

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBP4