SRPR beta (SRPRB) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Canine, Chicken |
Immunogen | Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit |
SRPR beta (SRPRB) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Canine, Chicken |
Immunogen | Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE |
SRPR beta (SRPRB) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 206-236 amino acids from the C-terminal region of Human SRPRB. |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the C terminal of human SRPRB. Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRPRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
SRPRB mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2B9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2B9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 3E6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 3E6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 5G5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 5G5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2D4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2D4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRPRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2D7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SRPRB mouse monoclonal antibody,clone 2D7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SRPRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |