Primary Antibodies

View as table Download

Rabbit Polyclonal LIF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF.

Rat Monoclonal LIF Antibody (39N7D10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-leukemia inhibitory factor (LIF) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human LIF

Rabbit Polyclonal Anti-LIF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIF antibody: synthetic peptide directed towards the N terminal of human LIF. Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ