Primary Antibodies

View as table Download

Rabbit polyclonal anti-5-HT-1F antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1F.

5 HT1F (HTR1F) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-HTR1F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR1F antibody: synthetic peptide directed towards the N terminal of human HTR1F. Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV