Primary Antibodies

Jump to Filters
View as table Download
Factor VIII (F8) Rabbit Polyclonal Antibody
TA325456

USD 345.00

4 Weeks

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.
Factor VIII (F8) Rabbit Polyclonal Antibody
TA342832

USD 375.00

5 Days

Rabbit Polyclonal Anti-F8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ