Factor VIII (F8) Rabbit Polyclonal Antibody

CAT#: TA342832

Rabbit Polyclonal Anti-F8 Antibody

Product Images

WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

• 

  Host: Rabbit; Target Name: F8; Sample Tissue: 721_B Whole Cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane; Gel Concentration: 0

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: coagulation factor VIII
• Database Link:
  NP_000123
  Entrez Gene 2157 Human
  UniProt ID P00451
• Background: This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.
• Synonyms: AHF; DXS1253E; F8B; F8C; FVIII; HEMA
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Dog

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Complement and coagulation cascades