IRF5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF5 |
IRF5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF5 |
Goat Polyclonal Antibody against IRF5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGPWPMHPAGMQ, from the C Terminus of the protein sequence according to NP_002191.1; NP_116032.1; NP_001092097.1; NP_001092099.1. |
Rabbit polyclonal IRF5 Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IRF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-108 amino acids from the N-terminal region of human IRF5. |
Rabbit polyclonal anti-IRF5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human IRF5. |
Rabbit Polyclonal Anti-IRF5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the middle region of human IRF5. Synthetic peptide located within the following region: IFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQ |
Rabbit Polyclonal Anti-IRF5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IRF5 Antibody: synthetic peptide directed towards the N terminal of human IRF5. Synthetic peptide located within the following region: PTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQD |
Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |