Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70)

LDB1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human LDB1

Rabbit polyclonal Anti-LDB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDB1 antibody: synthetic peptide directed towards the C terminal of human LDB1. Synthetic peptide located within the following region: VVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANS

Rabbit polyclonal Anti-LDB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDB1 antibody: synthetic peptide directed towards the middle region of human LDB1. Synthetic peptide located within the following region: EPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPD