LDB1 Rabbit Polyclonal Antibody

CAT#: TA331479

Rabbit polyclonal Anti-LDB1 Antibody

Product Images

WB Suggested Anti-LDB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LDB1 antibody: synthetic peptide directed towards the C terminal of human LDB1. Synthetic peptide located within the following region: VVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: LIM domain binding 1
• Database Link:
  NP_003884
  Entrez Gene 8861 Human
  UniProt ID Q86U70
• Background: LDB1 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes.
• Synonyms: CLIM2; NLI
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors