Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal Gastrokine 1 Antibody
Applications | WB |
Reactivities | Human, Equine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |