Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1.

GCNT3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 390-418 amino acids from the C-terminal region of Human GCNT3

GCNT3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72-102 amino acids from the N-terminal region of human GCNT3

Goat Polyclonal Antibody against GCNT3 (aa 273 to 284)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDTLHLTNKKKD, from the internal region of the protein sequence according to NP_004742.1.