GCNT3 Rabbit Polyclonal Antibody

CAT#: TA332087

Rabbit Polyclonal Anti-GCNT3 Antibody

Product Images

WB Suggested Anti-GCNT3 Antibody Titration: 1.25ug/ml; Positive Control: 293T cells lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: glucosaminyl (N-acetyl) transferase 3, mucin type
• Database Link:
  NP_004742
  Entrez Gene 9245 Human
  UniProt ID O95395
• Background: This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.
• Synonyms: 4GnT; C2; C2GNT2; C2GNTM; C24GNT; GNTM
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 91%; Yeast: 89%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis