Primary Antibodies

Jump to Filters
View as table Download
SUR1 (ABCC8) Goat Polyclonal Antibody
TA303367

USD 375.00

In Stock

Goat Polyclonal Antibody against ABCC8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2.
SUR1 (ABCC8) Rabbit Polyclonal Antibody
TA332362

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
SUR1 (ABCC8) Rabbit Polyclonal Antibody
TA373140

USD 275.00

3 Weeks

ABCC8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human ABCC8 (NP_000343.2).
Modifications Unmodified