Rabbit anti-CHMP2B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHMP2B |
Rabbit anti-CHMP2B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHMP2B |
Rabbit Polyclonal Anti-Chmp2b Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for anti-Chmp2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Chmp2b. Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK |
CHMP2B Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-213 of human CHMP2B (NP_054762.2). |
Modifications | Unmodified |