Primary Antibodies

Jump to Filters
View as table Download
DCC Rabbit Polyclonal Antibody
TA339003

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
DCC Rabbit Polyclonal Antibody
TA375344

USD 220.00

3 Weeks

DCC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human DCC
Modifications Unmodified