Primary Antibodies

Jump to Filters
View as table Download
DGKD Rabbit Polyclonal Antibody
TA347714

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-DGKD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD
DGKD Rabbit Polyclonal Antibody
TA314762

USD 345.00

4 Weeks

Rabbit polyclonal anti-DGKD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKD.
Dgkd Rabbit Polyclonal Antibody
TA337750

USD 375.00

5 Days

Rabbit Polyclonal Anti-Dgkd Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for anti-Dgkd antibody is: synthetic peptide directed towards the middle region of Mouse Dgkd. Synthetic peptide located within the following region: MAYETKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHS
DGKD Rabbit Polyclonal Antibody
TA338223

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGKD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL
DGKD Rabbit Polyclonal Antibody
TA375438

USD 220.00

3 Weeks

DGKD Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2).
Modifications Unmodified