Dgkd Rabbit Polyclonal Antibody

CAT#: TA337750

Rabbit Polyclonal Anti-Dgkd Antibody

Product Images

Host: Rabbit; Target Name: Dgkd; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dgkd antibody is: synthetic peptide directed towards the middle region of Mouse Dgkd. Synthetic peptide located within the following region: MAYETKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 134 kDa
• Gene Name: diacylglycerol kinase, delta
• Database Link:
  NP_808314
  Entrez Gene 227333 Mouse
• Background: The function of this protein remains unknown.
• Synonyms: DGK-delta; dgkd-2; DGKdelta; FLJ26930; KIAA0145
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 79%