Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-DGKD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD |
Antibodies
View as table Download
DGKD rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 34-88 of Human DGK-δ. |
Rabbit polyclonal anti-DGKD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKD. |
Rabbit Polyclonal Anti-Dgkd Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Dgkd antibody is: synthetic peptide directed towards the middle region of Mouse Dgkd. Synthetic peptide located within the following region: MAYETKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHS |
Rabbit Polyclonal Anti-DGKD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL |
DGKD rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DGKD |
DGKD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DGKD