Primary Antibodies

Jump to Filters
View as table Download
EIF4EL3 (EIF4E2) Rabbit Polyclonal Antibody
TA345899

USD 410.00

5 Days

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY
EIF4EL3 (EIF4E2) Rabbit Polyclonal Antibody
TA375827

USD 220.00

3 Weeks

EIF4E2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human EIF4E2 (NP_004837.1).
Modifications Unmodified