EIF4EL3 (EIF4E2) Rabbit Polyclonal Antibody

CAT#: TA345899

Rabbit Polyclonal Anti-EIF4E2 Antibody

Product Images

WB Suggested Anti-EIF4E2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate; There is BioGPS gene expression data showing that EIF4E2 is expressed in HepG2

• 

  Rabbit Anti-EIF4E2 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: eukaryotic translation initiation factor 4E family member 2
• Database Link:
  NP_004837
  Entrez Gene 9470 Human
  UniProt ID O60573
• Background: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.
• Synonyms: 4E-LP; 4EHP; EIF4EL3; IF4e
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway