Primary Antibodies

View as table Download

Goat Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1.

Rabbit Polyclonal Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE

IDS Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-290 of human IDS (NP_006114.1).
Modifications Unmodified