Iduronate 2 sulfatase (IDS) Rabbit Polyclonal Antibody

CAT#: TA343089

Rabbit Polyclonal Anti-IDS Antibody

Product Images

WB Suggested Anti-IDS Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: iduronate 2-sulfatase
• Database Link:
  NP_000193
  Entrez Gene 3423 Human
  UniProt ID P22304
• Background: Iduronate-2-sulfatase is required for the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this X-chromosome gene that result in enzymatic deficiency lead to the sex-linked Mucopolysaccharidosis Type II, also known as Hunter Syndrome. Iduronate-2-sulfatase has a strong sequence similarity with human arylsulfatases A, B, and C, and human glucosamine-6-sulfatase. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described.
• Synonyms: MPS2; SIDS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycosaminoglycan degradation, Lysosome, Metabolic pathways