Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PDE3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD

PDE3A Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 380-660 of human PDE3A (NP_000912.3).