PDE3A Rabbit Polyclonal Antibody

CAT#: TA335262

Rabbit Polyclonal Anti-PDE3A Antibody

Product Images

WB Suggested Anti-PDE3A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 125 kDa
• Gene Name: phosphodiesterase 3A
• Database Link:
  NP_000912
  Entrez Gene 5139 Human
  UniProt ID Q14432
• Background: PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
• Synonyms: CGI-PDE; CGI-PDE-A; CGI-PDE A
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Insulin signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism