Primary Antibodies

Jump to Filters
View as table Download
POLR1D Rabbit Polyclonal Antibody
TA346781

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
POLR1D Rabbit Polyclonal Antibody
TA380134

USD 220.00

3 Weeks

POLR1D Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human POLR1D (NP_057056.1).
Modifications Unmodified