POLR1D Rabbit Polyclonal Antibody

CAT#: TA346781

Rabbit Polyclonal Anti-POLR1D Antibody

Product Images

WB Suggested Anti-POLR1D Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: polymerase (RNA) I subunit D
• Database Link:
  NP_057056
  Entrez Gene 51082 Human
  UniProt ID P0DPB6
• Background: The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011]
• Synonyms: AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase