POLR1D (NM_015972) Human Recombinant Protein

CAT#: TP301466

Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Product Images

Coomassie blue staining of purified POLR1D protein (Cat# TP301466). The protein was produced from HEK293T cells transfected with POLR1D cDNA clone (Cat# RC201466) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201466 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY
  TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057056
• Locus ID: 51082
• UniProt ID: P0DPB6
• Cytogenetics: 13q12.2
• Refseq Size: 817
• Refseq ORF: 399
• Synonyms: AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2
• Summary: The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011]
• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase